Dataset for protein BAX-like of organism Crassostrea gigas

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|K1P6Q7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Crassostrea gigas GN=BAK1 (length=623 residues).
MAESKKTELEIHREMMTLLSHLRENKTRVRKKVPMAQTSKQEIKADVRKILEQFLKKQQLNDDEEEGAIPTGFQREDVEN
VTETYRSGSTNTSWEEYECLRCEAGCRSKVIKSIPTCSNRSPTDDTTNFTFIDEYEHDVERSHKDHSESVNKRGDVVQNV
HTHKISHVEQHNYTNGNKSGMLMESEVWECKDLAGKSEHKHGERHSNIRETMRPRHATSGRTSSEKDRLYTAVAEKLAHI
GDHYKATSPLSDSTRSSVDNTATRRASARTPNLPGVDERGSDGLTALERQLIDSLREVGDSFQLKLSPNAVKEIVKQAMY
QRFQEVVDKKTGPGNSWDHIAAVFYLTKKVVTMAGVGRAVALQVKDLAAEYVADKFATWIVDQGGWGDLGQMAYWDGGSG
TRGGGRVPPSSDVRQIPSPSEQMTPDTEENVIDEAEDVIRNFIFESYQHQLVEEVDTLDSTTPQVPELCAFTSDPMSRAS
QVGRQLARIGDDINRRYADEFKDMINQLNVNEDTAYEVFAGVAKKLFADEINWGRVAALMCLAYRITMTVVKEKAKKFAQ
FMKVIVSHVVRFIKEKIAGWIASQGGWSAALQYSPSMSFTSLSIVVGSCVAAIAAVFYFSKKS
>gnl|bcl2dbpro|K1RL21_BAX-01 BCL2-associated X protein OS=[Eukaryota] Crassostrea gigas GN=BAX (length=153 residues).
MEDLQDPGTPTGPPLEYVREIGRALRCIGDELDRNEQIQNLVDQVTPSANHETFFNVANSFFSDGVYNWGRVGCLFYFAY
KMAVKALSKINLIRSIVNWVVNFITDYVAGWIIDRGGWDAIIEYFGTPQNQFFGVVGLGITVCAGLYLWKALK
© 1998-2019