Dataset for protein Bax of organism Crassostrea gigas

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K1RL21_BAX-01 BCL2-associated X protein OS=[Eukaryota] Crassostrea gigas GN=BAX (length=153 residues).
MEDLQDPGTPTGPPLEYVREIGRALRCIGDELDRNEQIQNLVDQVTPSANHETFFNVANSFFSDGVYNWGRVGCLFYFAY
KMAVKALSKINLIRSIVNWVVNFITDYVAGWIIDRGGWDAIIEYFGTPQNQFFGVVGLGITVCAGLYLWKALK
© 1998-2019