Dataset for protein Bak1 of organism Crassostrea gigas

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K1P6Q7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Crassostrea gigas GN=BAK1 (length=623 residues).
MAESKKTELEIHREMMTLLSHLRENKTRVRKKVPMAQTSKQEIKADVRKILEQFLKKQQLNDDEEEGAIPTGFQREDVEN
VTETYRSGSTNTSWEEYECLRCEAGCRSKVIKSIPTCSNRSPTDDTTNFTFIDEYEHDVERSHKDHSESVNKRGDVVQNV
HTHKISHVEQHNYTNGNKSGMLMESEVWECKDLAGKSEHKHGERHSNIRETMRPRHATSGRTSSEKDRLYTAVAEKLAHI
GDHYKATSPLSDSTRSSVDNTATRRASARTPNLPGVDERGSDGLTALERQLIDSLREVGDSFQLKLSPNAVKEIVKQAMY
QRFQEVVDKKTGPGNSWDHIAAVFYLTKKVVTMAGVGRAVALQVKDLAAEYVADKFATWIVDQGGWGDLGQMAYWDGGSG
TRGGGRVPPSSDVRQIPSPSEQMTPDTEENVIDEAEDVIRNFIFESYQHQLVEEVDTLDSTTPQVPELCAFTSDPMSRAS
QVGRQLARIGDDINRRYADEFKDMINQLNVNEDTAYEVFAGVAKKLFADEINWGRVAALMCLAYRITMTVVKEKAKKFAQ
FMKVIVSHVVRFIKEKIAGWIASQGGWSAALQYSPSMSFTSLSIVVGSCVAAIAAVFYFSKKS
© 1998-2019