Dataset for protein Unclassified of organism Corbicula fluminea

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1P8SNM5_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Corbicula fluminea (length=227 residues).
MSNGSPAFSGINSTANNQRPNNLFLEIHNRWGNLSGNQGLNESMNEDVGSTGSLLKKVEKQAEAIAVDVFDNYEVEQEQR
CPDRFCKAMRQTVKEVSDRYEVALRSKVDTFTNRRDCDMFQNFVKVADELFEDGVINWGKVIFLYAFASRLTAYLKKNNP
ENKDKIGLYVGKYVGSKHGRWILDNGGWDSFADSFLRENAVKDKTWMGILLSKALGAKDPSANSMAN
© 1998-2019