Dataset for protein Unclassified of organism Common bottlenose dolphin gammaherpesvirus 1 strain Sarasota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1Z1NED3_uncBAX-01 Putative BCL2-associated X protein OS=[Viruses] Common bottlenose dolphin gammaherpesvirus 1 strain Sarasota (length=202 residues).
MLPDDQSGGLPEGQPAPENGAPGNAPPTPRSDHNSFYADSLRETSTVLSNVMTAVLNPSLHVRHLTASELLLMKLTRECI
NDNCFKLTNIVLQMRVENTDNYYPIVMKIVVDSYVDGNMNWGRLCATMAFVCVFMRHLVGSTQETIDIFAHLLSSFYMNK
HLKWLVDVNGLSAGARSHFPISWTWCSCQLLFYRLMLRRSRK
© 1998-2019