Dataset for protein Bok of organism Colobus angolensis palliatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5I0T0_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Colobus angolensis palliatus GN=BOK (length=171 residues).
PTGCPHCLQGLDCRGWDQPLCVCPVPSPQLGCRDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWG
KVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFL
KAAFFVLLPER
© 1998-2019