Dataset for protein BAX-like of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A2K5I0T0_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Colobus angolensis palliatus GN=BOK (length=171 residues).
PTGCPHCLQGLDCRGWDQPLCVCPVPSPQLGCRDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWG
KVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFL
KAAFFVLLPER
>gnl|bcl2dbpro|A0A2K5IYH0_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAK1 (length=153 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASRPAATPTACLRVASTGAVWWLFWASATVWPYTSTSAA
>gnl|bcl2dbpro|A0A2K5IYH0_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A2K5JHM2_BAX-04 BCL2-associated X protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAX (length=184 residues).
MDGSGEQPRGGGVTPRSDSAPSLHPHSRRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSP
REVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTP
TWQTVTILVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A2K5JHM2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTILVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A2K5JHM2_BAX-05 BCL2-associated X protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAX (length=197 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
LLNPPHPNHRPCPTVPWCPLPIFGSSDVVYNAFPYVS
>gnl|bcl2dbpro|A0A2K5JHM2_BAX-03 BCL2-associated X protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAX (length=198 residues).
MDGSGEQPRGGVSSRIEQGEWLALDPVPQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDG
NFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLLSLSPGRPPLLLWD
AHVADRDHLGGWSTHCLAHHLEEDGLRPPAALNCVFPP
>gnl|bcl2dbpro|A0A2K5JHM2_BAX-02 BCL2-associated X protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAX (length=143 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKV
PELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGVLTASLTIWKKMG
© 1998-2019