Dataset for protein Bak1 of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5IYH0_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAK1 (length=153 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASRPAATPTACLRVASTGAVWWLFWASATVWPYTSTSAA
>gnl|bcl2dbpro|A0A2K5IYH0_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
© 1998-2019