Dataset for protein BAX-like of organism Clarias batrachus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0X9GII2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Clarias batrachus GN=BAX (length=193 residues).
MAAALSGGGDGGSSNDQILEIGAVLLKEFIYERVRRHGDSSAVVSRNELGGSELCDPTHKKLAQCLQQIGDELDNHADLQ
RMLSDSSLQPTKDVFVKVAREIFSDGKFNWGRVVALFYFACRLVIKALLTKIPDIIRTIINWTLDYLREHVINWIREQGG
WEGIRSYFGTPTWQTVGVFLAGVLTTVLVMRKM
© 1998-2019