Dataset for protein Unclassified of organism Ciona savignyi

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|H2Z3W0_uncBOK-01 Putative BCL2-related ovarian killer protein OS=[Eukaryota] Ciona savignyi (length=270 residues).
MASRCKVTPNANDVNHNSVFEPIETNKPSSVLQSMNSFMRDSVSYVTSSCASMASSLASYGDDSVFHSTSYEDDVTLTIG
ICRDYICYRVKRDGFGSRVTVKLYAPAVDQTMSSNILNLGSSFERMFPKSFRQVSRQIGCLFNSEDAIRRLYFRLAVHIL
GVLEENYTWGRILALLALAGAMAVDCISQGHPGLVEPMIAISSDFIRKNSLDWIIKKGGWHALVDHFSPESAQPCWSGLC
LLKSHTALPVALFIFSLLLLALVIHLFSVD
>gnl|bcl2dbpro|H2ZK76_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Ciona savignyi (length=252 residues).
MKSTKMVQQTRRVVEDYILYRINDAITNETFDSFSSRCSGVDQAWRGFPLPQSNPAKLYLAMRKIGADYERRYKETFPDL
LDEIKSVNMSTDDVDRTFSRICKDLFRLPLKKAFQDTLNTRPAGPDQATNKVYIQSDILNVDDGHIKWGHVIALLVFAAI
VAVRAVELRKPEQVDAIVSWVTKFIDAELSSWLNKQGGWDNLLEWSEGEHHLQRQTDISFNPKDFATSFRSAISVGVVAA
CVGLGALMLTRK
© 1998-2019