Dataset for protein Unclassified of organism Ciona intestinalis

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|F6TGL0_uncBOK-01 Putative BCL2-related ovarian killer protein OS=[Eukaryota] Ciona intestinalis (length=178 residues).
MQKHLYSDVSKQIGITLRSEDVLRKVFFELAGEILTTEPVTIPKEATVNGETKKEKSRAFVSSGSRIIEITWGRICAVVA
IAGGLSIDCVNQGHSDLVNQLIEFCGEFASEEGVLRWIVSQGGWETLREMTDDHSASHTANDYGYLTHICNVALALTACT
LATVLSVVAIASVSDTAG
>gnl|bcl2dbpro|F6WDB5_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Ciona intestinalis (length=245 residues).
MVQQTRRVVEDYVLFRIHETIASESYDSFSSRCKLEDQASRGFPLPQTNPARLNVSIRKIAAEYERRYRETFPDLLEEIK
TVNMSTDDVDKTFSRICKDLFQLPLKRNYPDNAMKSQATSNSKIFIQSDILEVEDNHVKWGHVIALLVFAAIVAVRAVEL
KKHEQVDAIVSWVSKFIDTELTGWLNKQGGWENVIEWSEAGETRLQLQKDTSFDPNNFSSSFRSAISVGVVAACVGLGAL
IMTRK
>gnl|bcl2dbpro|F7ABX1_uncBOK-01 Putative BCL2-related ovarian killer protein OS=[Eukaryota] Ciona intestinalis (length=266 residues).
MTSYTSDVNHNSIYETERKNKRTLLADNINSIMRDSVTFVTSSIADLTSSCVSLGDDSVFNSTSYEEDVRLTTGICRDYI
CYRLKRDGFGERVTVTEHAPAHNHNLSNKILNLGSGFERMFPKSFRQISRQIGYVFSSEATVRRLYFRMGVHIMGVVECN
YTWGRILSLLGLAGAMAVDCISQGHPELAESMIGISSDFIQRNALDWIIKHGGWGGLVDNFSPKPMKSYWSTRNILKWNG
GVTLAVFILLFALMLAILPRLKTNDN
© 1998-2019