Dataset for protein BAX-like of organism Ciona intestinalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6YVN3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Ciona intestinalis GN=BAX (length=165 residues).
FLLNMFIQDRAGVENSPVEPVSAGFTDENLSDIAVTLRRIGDDMSRDIQLNRFIDQVPLKSTKDIFIKVCLQMFEDGNFN
WGRIVALFYFAYRLIVRSLLSGLDSLPWIRELISWVVDFIVKKFAKWIISRGGWTMIKEWFGISSQTFGVLICVTLAIVG
WAVFK
© 1998-2019