Dataset for protein Bok of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9R0C9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
© 1998-2019