Dataset for protein BAX-like of organism Chlorocebus sabaeus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A0D9R0C9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
>gnl|bcl2dbpro|A0A0D9RB69_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGHVTRFVVD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A0D9S330_BAX-01 BCL2-associated X protein OS=[Eukaryota] Chlorocebus sabaeus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTILVAGVLTASLTIWKKMG
© 1998-2019