Dataset for protein BAX-like of organism Cercocebus atys

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=174 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGPAAPADPEMVTLPLQPSSTVGQVGRQITMLQHLQ
RTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVSLPS
LLPCRGCPSKAQKL
>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=172 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGSTVGQVGRQITMLQHLQRTAENAYEYFTKIASSL
FESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVAALDLGNGPILNMLVILGVVL
LGPFVVQRFFKS
>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=189 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGPAAPADPEMVTLPLQPSSTVGQVGRQITMLQHLQ
RTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVAALD
LGNGPILNMLVILGVVLLGPFVVQRFFKS
>gnl|bcl2dbpro|A0A2K5KU58_BAX-02 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=143 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKV
PELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A2K5KU58_BAX-04 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=203 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
LLNPPHPNHRPCPTVPAHPLSQWCPLPIFGSSDVVYNAFPYVS
>gnl|bcl2dbpro|A0A2K5KU58_BAX-03 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=185 residues).
MDGSGEQPRGGGEAGGRRAGGGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMIAAVDTDS
PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
PTWQTVTILVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A2K5KU58_BAX-01 BCL2-associated X protein OS=[Eukaryota] Cercocebus atys GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTILVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A2K5L9Q9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cercocebus atys GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
>gnl|bcl2dbpro|A0A2K5N1M7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQQLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A2K5N1M7_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=153 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQQLQPTAENAYEYFTKIASRPAATPTACLRVASTGAVWWLFWASATVWPYTSTSTA
© 1998-2019