Dataset for protein Bak1 of organism Cercocebus atys

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=174 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGPAAPADPEMVTLPLQPSSTVGQVGRQITMLQHLQ
RTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVSLPS
LLPCRGCPSKAQKL
>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=172 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGSTVGQVGRQITMLQHLQRTAENAYEYFTKIASSL
FESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVAALDLGNGPILNMLVILGVVL
LGPFVVQRFFKS
>gnl|bcl2dbpro|A0A2K5KTQ1_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=189 residues).
MASGQGPGFPRQECGELALPSASEEQVTRDMEKVFDRHQQEQEAEGPAAPADPEMVTLPLQPSSTVGQVGRQITMLQHLQ
RTAENAYEYFTKIASSLFESGINQGRVVALLGFSYHLVLHVYQRGLTGFLGQVTRFVVFMLQHCIAWWIAQRGSWVAALD
LGNGPILNMLVILGVVLLGPFVVQRFFKS
>gnl|bcl2dbpro|A0A2K5N1M7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQQLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A2K5N1M7_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cercocebus atys GN=BAK1 (length=153 residues).
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEMDTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQQLQPTAENAYEYFTKIASRPAATPTACLRVASTGAVWWLFWASATVWPYTSTSTA
© 1998-2019