Dataset for protein BAX-like of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K5Q7S1_BAX-02 BCL2-associated X protein OS=[Eukaryota] Cebus capucinus imitator GN=BAX (length=159 residues).
MDGSGEQPRGEGEAGGSRAEGGRAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIATVDTNSPREVFFRVAAD
MFSDGNFNWGRVVAFFYFASKLVLKVGSCRAVSPGIQTIISWGLSDSLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5Q7S1_BAX-03 BCL2-associated X protein OS=[Eukaryota] Cebus capucinus imitator GN=BAX (length=157 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
ATVDTNSPREVFFRVAADMFSDGNFNWGRVVAFFYFASKLVLKDSLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5QZM8_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cebus capucinus imitator GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSIYRNVAHQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPSLRSHWLLTALCSFGRFLKAAFFVLLPER
>gnl|bcl2dbpro|A0A2K5SIP9_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGESDPPSASEAQVARDTEEVFHSYVFYRHQQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
© 1998-2019