Dataset for protein Bax of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5Q7S1_BAX-02 BCL2-associated X protein OS=[Eukaryota] Cebus capucinus imitator GN=BAX (length=159 residues).
MDGSGEQPRGEGEAGGSRAEGGRAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIATVDTNSPREVFFRVAAD
MFSDGNFNWGRVVAFFYFASKLVLKVGSCRAVSPGIQTIISWGLSDSLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5Q7S1_BAX-03 BCL2-associated X protein OS=[Eukaryota] Cebus capucinus imitator GN=BAX (length=157 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
ATVDTNSPREVFFRVAADMFSDGNFNWGRVVAFFYFASKLVLKDSLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
© 1998-2019