Dataset for protein Unclassified of organism Cavia porcellus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|H0VIM5_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Cavia porcellus (length=192 residues).
MDGSGEHPRGSGPTSSEHIMKTGALLLQGFIQDRAGRMGGDTLELAMEPAPQDASTKKLGECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRDRLLSWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|H0VIM5_uncBAX-02 Putative BCL2-associated X protein OS=[Eukaryota] Cavia porcellus (length=74 residues).
MDGSGEHPRGSGPTSSEHIMKTGALLLQGMIAAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKLVLK
© 1998-2019