Dataset for protein Bok of organism Cavia porcellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A286XGM4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cavia porcellus GN=BOK (length=179 residues).
VRIRLVAMGLGEVKWRSAWRSWGPSQPGMGAVSHSHVCPPGDELEQIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHI
FSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPSLHSHWLVAA
LCNFGRFLKAAFFVLLPER
© 1998-2019