Dataset for protein BAX-like of organism Cavia porcellus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A286XGM4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cavia porcellus GN=BOK (length=179 residues).
VRIRLVAMGLGEVKWRSAWRSWGPSQPGMGAVSHSHVCPPGDELEQIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHI
FSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPSLHSHWLVAA
LCNFGRFLKAAFFVLLPER
>gnl|bcl2dbpro|H0UT71_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cavia porcellus GN=BAK1 (length=214 residues).
MASDQGPGPLREGCGGASPLSEEEQQVVRDTEEVFQSYVYHRHQQDRGGTQGRVPRAHPTAHCCFLSSTLTQVGCQLAII
GDDINRRYGSDIEAMLQQLQPTADNAPDLFYKIACSLFKPGPTWGRVVALLAFGYRLALHVYQQHGLSGFLGKVTRLVVD
SMLQLNVVRWIVEKGGWVAALDWAGTFRPIWTVVTAFAIVMVGQYVIRRFFKSS
© 1998-2019