Dataset for protein Bak1 of organism Cavia porcellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0UT71_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Cavia porcellus GN=BAK1 (length=214 residues).
MASDQGPGPLREGCGGASPLSEEEQQVVRDTEEVFQSYVYHRHQQDRGGTQGRVPRAHPTAHCCFLSSTLTQVGCQLAII
GDDINRRYGSDIEAMLQQLQPTADNAPDLFYKIACSLFKPGPTWGRVVALLAFGYRLALHVYQQHGLSGFLGKVTRLVVD
SMLQLNVVRWIVEKGGWVAALDWAGTFRPIWTVVTAFAIVMVGQYVIRRFFKSS
© 1998-2019