Dataset for protein BAX-like of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A250YBQ3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Castor canadensis GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDSNMELQRMI
ADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A250YBQ3_BAX-02 BCL2-associated X protein OS=[Eukaryota] Castor canadensis GN=BAX (length=173 residues).
MKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADM
FADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKKMG
>gnl|bcl2dbpro|A0A250YC64_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Castor canadensis GN=BAK1 (length=166 residues).
MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQGAAAPADPELVSLPQEPNSTMGQVGRRLAI
IGDDINRRYDTEFQTMLQQLRPTAENASELFTKIASRCTAWPLCPLSRHHPCMQWAPWSGHTSLAVSGGSVLTHMWSLSP
LLCINS
>gnl|bcl2dbpro|A0A250YC64_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Castor canadensis GN=BAK1 (length=211 residues).
MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQGAAAPADPELVSLPQEPNSTMGQVGRRLAI
IGDDINRRYDTEFQTMLQQLRPTAENASELFTKIASSLFDSGISWGRVVALLSFGYRLAVHVYQRGLTGFLGQVTYFVID
VMLRHYITRWIAQRGGWVAALELGNGPIRNVVIVLAVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A250YC64_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Castor canadensis GN=BAK1 (length=138 residues).
MASGQGPGPPKEGLEEPSSDSTSEQQVVQDTEEVFRSYVFYRHQQEQEAQGAAAPADPELVSLPQEPNSTMGQVGRRLAI
IGDDINRRYDTEFQTMLQQLRPTAENASELFTKIASRPAATPTVCLTVASAGAVWWLS
© 1998-2019