Dataset for protein Bok of organism Carassius auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B0I3D7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Carassius auratus GN=BOK (length=207 residues).
MLRRSSVFAAEVMEAFDRSPTDKELVSQSKVLCRDYIHSRLHQLGSDGLNQSMDPEEHWLRCRQSSVVGDELEYLRPNVY
RNVARQLNISISSESIVSDAFLAVAAEIFSTGVTWGKIVSLYAVAGALAVDCVRQGYPAMVHTIVDCMGEFVRKSLVSWL
KRRGGWVDITKCVVNTDPSFRSHWLVAAACACGHFLKAVVFYLLREK
© 1998-2019