Dataset for protein Bok of organism Capra hircus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452G7C4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Capra hircus GN=BOK (length=213 residues).
MEVLRRSSVLAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGGRLAEVCAVLLRLADELEL
IRPSVYRNVARQLNLSLQSETVVTDAFLAVATQIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEFVRK
TLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFMLLPER
© 1998-2019