Dataset for protein BAX-like of organism Capra hircus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A076FVB8_BAX-01 BCL2-associated X protein OS=[Eukaryota] Capra hircus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A452EUN4_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Capra hircus GN=BAK1 (length=211 residues).
MASGQGPGPPRQGCDEPDPSSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEMVTLHPEPTSTMGQVGRQLAV
IGDDINRRYDTEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLRRSIARWIAQRGGWVAALDLGNAPIKNVAIVLAVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A452G7C4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Capra hircus GN=BOK (length=213 residues).
MEVLRRSSVLAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGGRLAEVCAVLLRLADELEL
IRPSVYRNVARQLNLSLQSETVVTDAFLAVATQIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEFVRK
TLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFMLLPER
© 1998-2019