Dataset for protein Unclassified of organism Canis lupus familiaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|J9NV03_uncBOK-01 Putative BCL2-related ovarian killer protein OS=[Eukaryota] Canis lupus familiaris (length=76 residues).
MEVLRRSSVLAAEIMDAFDRSPSDKELVAQAKALGREFVHARLLRAGLAWTAPERAAPAPGGRLAEVCAVLLRLGE
© 1998-2019