Dataset for protein BAX-like of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|F1PAN9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Canis lupus familiaris GN=BAX (length=182 residues).
MSHPSSLGPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIG
DELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRER
LLGWIQDQGGWVRPVTPSPQLL
>gnl|bcl2dbpro|F1PAN9_BAX-02 BCL2-associated X protein OS=[Eukaryota] Canis lupus familiaris GN=BAX (length=164 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
PVTP
>gnl|bcl2dbpro|F6PMP8_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BAK1 (length=243 residues).
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEMVTLPLEPSSTMGQVGRQLAI
IGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHPLSVSE
NKL
>gnl|bcl2dbpro|Q52HB2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BAK1 (length=211 residues).
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEMVTLPLEPSSTMGQVGRQLAI
IGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|Q8HYU5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Canis lupus familiaris GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELPLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
© 1998-2019