Dataset for protein Bak1 of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F6PMP8_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BAK1 (length=243 residues).
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEMVTLPLEPSSTMGQVGRQLAI
IGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHPLSVSE
NKL
>gnl|bcl2dbpro|Q52HB2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Canis lupus familiaris GN=BAK1 (length=211 residues).
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEMVTLPLEPSSTMGQVGRQLAI
IGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLHHCIARWIAQRGGWVAALNLGNGPILNVLIVLSVVLLGQFVVRRFFKS
© 1998-2019