Dataset for protein BAX-like of organism Callorhinchus milii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|K4FTK7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Callorhinchus milii GN=BOK (length=213 residues).
MDMLRRSSVFAAEVMEVFERSPPDKELVSQAKALCRDYIHSRLIRAGIVWSKPECAAASPASKLTEVSAALLRLGDELEY
IRPNMYRNVAKQLNITVSSESIVSDAFLAVATEIFSAGITWGKVVALYAVAGGLAIDCVKQGQPAMVHTIVDCLGEFVRK
TLVTWLRRRGGWADITKSVVNNDPSIRDHWLVSAVCTFGHFVKAVFFFLLRER
© 1998-2019