Dataset for protein Bok of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6SBR3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Callithrix jacchus GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPFPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVNTDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
© 1998-2019