Dataset for protein BAX-like of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|F6SBR3_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Callithrix jacchus GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPFPGRLAEVCAVLLRLGDELEMI
RPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVNTDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
>gnl|bcl2dbpro|F7ICC2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|U3BU97_BAX-01 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=193 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|U3BU97_BAX-02 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=175 residues).
MDGSGEQPRGEGEAGGSRAGEGRTPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAD
MFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFV
AGVLTASLTIWKNMG
>gnl|bcl2dbpro|U3BU97_BAX-04 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=192 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
PLYPSCPASPDSSGTLGLPSRSQSSDVVYNAF
>gnl|bcl2dbpro|U3BU97_BAX-03 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=144 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKV
PELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
© 1998-2019