Dataset for protein Bax of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|U3BU97_BAX-01 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=193 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|U3BU97_BAX-02 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=175 residues).
MDGSGEQPRGEGEAGGSRAGEGRTPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAD
MFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFV
AGVLTASLTIWKNMG
>gnl|bcl2dbpro|U3BU97_BAX-04 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=192 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIAGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
PLYPSCPASPDSSGTLGLPSRSQSSDVVYNAF
>gnl|bcl2dbpro|U3BU97_BAX-03 BCL2-associated X protein OS=[Eukaryota] Callithrix jacchus GN=BAX (length=144 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKV
PELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
© 1998-2019