Dataset for protein Bak1 of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7ICC2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
© 1998-2019