Dataset for protein BAX-like of organism Caligus rogercresseyi

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|C1BQD5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Caligus rogercresseyi GN=BAX (length=204 residues).
MADSRERRKTGEDEPQGAVGGEDVIDDRIMEQGAVVLRGYVIERVSAENPERRLAPEDLGGRPNEQEDHQVKDVVHQLLL
IADDLNRNAELQHLISTVQVNCAQDVFFSVAREIFADGINWGRVVTLFHLAYKLIYKALTQNHLEIIKKVISWVLQFIRE
NVSAWIRQQGGWEAAVSTVSHWRTVSLVAAVAFVTAMVYWRKTR
© 1998-2019