Dataset for protein Bax of organism Botryllus schlosseri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A165NNF9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Botryllus schlosseri GN=BAX (length=259 residues).
MSGGGDQAKKEAGKIDDKNDEDPRPSRPTRPRTARPGRRTDPESSLVQGAVGGEGSYTRHLTEEERAVGNQARHLLTMFI
SDRAERDPDLSQDKKGAVQETVQLCNKSSESNAMSDSDAALREVSLTLRVIGDQLNEDNDLNSLIDRVLVQPTKDIFMKV
CKQIFADQNFNWGRVAAVFYFAYRLITKAVCTTMDEGIDWIKDIMSWAMDFLYQYVLWWIVQRGGWGMIREYFGTPTAYV
VSLSAATILTVLYVWWKQQ
© 1998-2019