Dataset for protein Bok of organism Bos taurus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A6H6W7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Bos taurus GN=BOK (length=213 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGGRLAEVCAVLLRLADELEL
IRPSVYRNVARQLNLSLQSETVVTDAFLAVATQIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEFVRK
TLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFMLLPER
© 1998-2019