Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A6H6W7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Bos taurus GN=BOK (length=213 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGGRLAEVCAVLLRLADELEL
IRPSVYRNVARQLNLSLQSETVVTDAFLAVATQIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEFVRK
TLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFMLLPER
>gnl|bcl2dbpro|O02703_BAX-01 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|O02703_BAX-03 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=336 residues).
MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEM
FSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLTPPHSPTPLGPLGLSVP
TIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLC
PLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIF
QGGGADLGAMEFFLLF
>gnl|bcl2dbpro|O02703_BAX-02 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=355 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
PLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESL
KFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEE
DGLRPSTALDFFCINYGIFQGGGADLGAMEFFLLF
>gnl|bcl2dbpro|Q05KI7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Bos taurus GN=BAK1 (length=211 residues).
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEMVTLHPEPSSTMGQVGRQLAV
IGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLRRSIARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
© 1998-2019