Dataset for protein Bax of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|O02703_BAX-01 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|O02703_BAX-03 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=336 residues).
MKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEM
FSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLTPPHSPTPLGPLGLSVP
TIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLC
PLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIF
QGGGADLGAMEFFLLF
>gnl|bcl2dbpro|O02703_BAX-02 BCL2-associated X protein OS=[Eukaryota] Bos taurus GN=BAX (length=355 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVR
PLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVTPDPMPRCPPWCLPPIPLESL
KFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESLKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEE
DGLRPSTALDFFCINYGIFQGGGADLGAMEFFLLF
© 1998-2019