Dataset for protein Bak1 of organism Bos taurus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q05KI7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Bos taurus GN=BAK1 (length=211 residues).
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEMVTLHPEPSSTMGQVGRQLAV
IGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVAD
FMLRRSIARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
© 1998-2019