Dataset for protein Bak1 of organism Bos mutus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|L8IT09_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Bos mutus GN=BAK1 (length=204 residues).
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYEQEAEGAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINR
RYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSI
ARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|L8IT09_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Bos mutus GN=BAK1 (length=195 residues).
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRPNSLAASRSSSTMGQVGRQLAVIGDDINRRYDAEFQAM
LQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGG
WVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
© 1998-2019