Dataset for protein Unclassified of organism Astyanax mexicanus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B1IJZ6_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Astyanax mexicanus (length=201 residues).
MEKSEPEQCLTDQGLSSPDPMVREAYLMAYDYINYVTAKPGAPLGPAPSVTSAALRHAGDELLQRFPIFFRRWPRVFQDV
TEESACTTLLSILDEHFAPTRRRDLAWSAVLSIFVLAGQMALHCQEKGMTRVLPQLQHCVGSYVERVICPEIKDKGGWSG
FVSRFGEKQSLEGQVKKVCCWSLFIFAAGILVYFLWKRRIT
>gnl|bcl2dbpro|A0A3B1K741_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Astyanax mexicanus (length=206 residues).
MACEETPDDQIGEALLIGVIEDQVKSVNAAGDTSSLGIPKPKPLSHAQNQMLLNQLADTIRVIGDRLDMDTGFNDMIDGL
GRVANKNSFWKLVEGVFSDGQINWGRIIVLFYSVGKLAAKMVLAHLPEVFSEILNLSLDYFRRTLLQWIRNMGGWINSIS
GVTRFSIEQFSASSFRRISPSAGQWVVFGAGVLLGGIIVWRLKRFT
© 1998-2019