Dataset for protein Bok of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B1IPM7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astyanax mexicanus GN=BOK (length=215 residues).
MKGMEVLRRSSVFAAEVMEVFERSPTDKELVSQSKVLCRDYIHSRLNRAGIGWSKADHGLSAGGSLGEVSSVLLWLGDEL
EYLRPNVYRNVARQLNITVASESVVSDAFLAVAAEIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFV
RKSLVSWLKRRGGWTDITKCVVNTDPSFRSHWLVAAACTCVHYLKAVVFYLLREK
>gnl|bcl2dbpro|W5KF74_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astyanax mexicanus GN=BOK (length=228 residues).
MDLMDRGPSEKELVFQSKILCRDFIYSRITREGLNWSKVESSLPVPVPDGALGDVSMVLLKLGDELEYMRPYIYRNVAKQ
LSISVSVESVVSDAFLSVATEILSLGITWGKVVAIFAVAGGSGGGLCPAGSSSHDTHYSGQPGGVRPEEPGALAEEERRL
GRHFKVCDERGHYTSVPLDVCSSINLEARCEDHVYLPDEVTVEAVAVNTAPGLELLGSLRLLMISELY
© 1998-2019