Dataset for protein Bax of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B1JGN3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astyanax mexicanus GN=BAX (length=181 residues).
MAAQGEGYAVNLLRIGYRLLINFISERLQRTLEIDAAVTKNLLDETEEVPDPNIKKVGQRLQQFGDELDNDTKLKEMINN
LMPTKEVFLKIAYEIFSDWKFNWGRVVALFYFACEFVKMVPDIISNIISWTLEFMRDHVIAWISGQGGWDAILSQIEAPS
WTTVTAFVAGVLTTALIVNKM
>gnl|bcl2dbpro|W5KCK0_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astyanax mexicanus GN=BAX (length=190 residues).
MFVCSVFKGNGNEQLLDLGASLLKDFIYQRVQRHGDSNALVTRNQLGGTELCDPSHKRLAQCLQQIGDELDSNVQLQSMI
NDSALQPTQDVFVKVACEIFSDGKFNWGRVVALFYFACRLVIKAVLTKLPDIIRTIINWTVDYLREHVINWIREQGGWEG
IRSYFGTPTWQTVGVFLAGVLTTVLVMRKM
>gnl|bcl2dbpro|W5KJ43_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astyanax mexicanus GN=BAX (length=204 residues).
MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTENPDVRVSRVDLGGRPDEGDDPQIKVVVEQLLR
IADDLNRNTELQHLISTVQANCAQDVFMTVARTIFTDGINWGRIVALFHLAYQLIYNALTQNHLEIIKNIISWVLQYIRQ
HVSAWIRQQGGWEGVIRSVSRWRTVTVIAAVAFIAAAVYWKRSR
>gnl|bcl2dbpro|W5KJ43_BAX-02 BCL2-associated X protein OS=[Eukaryota] Astyanax mexicanus GN=BAX (length=198 residues).
MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTENPDVRVSRVDLGGRPDEGDDPQIKVVVEQLLR
IADDLNRNTELQHLISTVQANCAQDVFMTVARTIFTDGINWGRIVALFHLAYQLIYNTLREETIMSNQQTLSNLPRELVR
TAVVEIVSTTRFLFWFQTSLTPWGKCFLCLLLFFSEAK
© 1998-2019