Dataset for protein Unclassified of organism Astatotilapia calliptera

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8PCY4_uncBAX-02 Putative BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera (length=203 residues).
MACAVNGMSDERIGEALIKEVIEEELKDVPSEDVPPLTPLAVEGKTEQEEKLVKQLSKMIRIVGDRVQHDQEFQDVIDGV
ASGSGSKSENFRRVADKVFEDGITWERIAVLIYVAGRLAVKMVEAHLPQSVREVLTWAVNFFKNNLLGWILEHGGWINSF
SELAAASIQRVSSMSSHSYGLIIIFLAGMSIGSFITWRLTRQS
>gnl|bcl2dbpro|A0A3P8PCY4_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera (length=223 residues).
MTSCVIVAFYCACSVTTENTDLFCFYSSTDERIGEALIKEVIEEELKDVPSEDVPPLTPLAVEGKTEQEEKLVKQLSKMI
RIVGDRVQHDQEFQDVIDGVASGSGSKSENFRRVADKVFEDGITWERIAVLIYVAGRLAVKMVEAHLPQSVREVLTWAVN
FFKNNLLGWILEHGGWINSFSELAAASIQRVSSMSSHSYGLIIIFLAGMSIGSFITWRLTRQS
>gnl|bcl2dbpro|A0A3P8QGD6_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Astatotilapia calliptera (length=149 residues).
MGVLNKEALSVNNGTMGPVPTACTAAMHHAGNELLTPFPIFQDVTENTACLILICILDEHFLPPTPGTKRRDLAWSTVLS
TVLSVHVLAGQMAIHCHDSGDGDGTARGMFKCGFVYHFLEKQDLVCQLDKVPPTFYGRECLSQHCPLLT
© 1998-2019