Dataset for protein Bok of organism Astatotilapia calliptera

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3P8R3S9_BOK-03 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-06 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-05 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-04 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVEITKCVVKKDFCPEENWLSSAFESLKCFLTTMYVYIMKEP
>gnl|bcl2dbpro|A0A3P8R8S7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=210 residues).
MEMLRRSSVFASEVFDRSPTDKELVSQAKALCREYIHSRLNRAGIGWSKPEHGLAASGGTLGEISSVLLWLGDELEYLRP
NVYRNVARQLNITVASESVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKKRGGWVDVTKCVVSTDPNFCSHWLVSAVCAFGHYLKTVVLHLLREK
© 1998-2019