Dataset for protein BAX-like of organism Astatotilapia calliptera

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A3P8N5H5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=274 residues).
MMVRTEYLNCGRTQSKTDKYSSVGRFLGEYLHLWDFCEACLRTAGPVATILPYHFRVLLLKGGFPQTRFGSMADGRGGQN
PEQEPRGAAGGDDVVDDSILEEGAVVFRGYVIAHINTEEPSRHVTSEDLGGRPDEQQDPQVKEVVEQLRKIADSLNRNAE
LQRLINQVQGNCVQDVFMAVARNIFADGINWGRVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQG
GWEGVIRGFSRWRTAAMVASVVLVVAFVYYRKVR
>gnl|bcl2dbpro|A0A3P8N5H5_BAX-02 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=203 residues).
MADGRGGQNPEQEPRGAAGGDDVVDDSILEEGAVVFRGYVIAHINTEEPSRHVTSEDLGGRPDEQQDPQVKEVVEQLRKI
ADSLNRNAELQRLINQVQGNCVQDVFMAVARNIFADGINWGRVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQ
VYSWLVAQGGWEGVIRGFSRWRTAAMVASVVLVVAFVYYRKVR
>gnl|bcl2dbpro|A0A3P8NNI6_BAX-02 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=192 residues).
MASHPGGGDQGNSGDQILEVGTILLQDFIYERVQRQGDGNKAVTREQLGGSQLTDPKHKKLAQCLQQIGDELDGNVELQR
MINDSSLCPTREVFMRVAYEIFSDGIFNWGRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGW
EGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM
>gnl|bcl2dbpro|A0A3P8NNI6_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=205 residues).
MASHPGGGDQGSSSYRQQIKYIYFDSDSVGGSPIDTDNVAFIYERVQRQGDGNKAVTREQLGGSQLTDPKHKKLAQCLQQ
IGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWGRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLR
EHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM
>gnl|bcl2dbpro|A0A3P8NNI6_BAX-03 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=200 residues).
MLIYQHLSHLMSVYLCLSGNSGDQILEVGTILLQDFIYERVQRQGDGNKAVTREQLGGSQLTDPKHKKLAQCLQQIGDEL
DGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWGRVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVIN
WIREQGGWEGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM
>gnl|bcl2dbpro|A0A3P8NNW3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Astatotilapia calliptera GN=BAX (length=165 residues).
MLIYQHLSHLMSVYLCLSWNSGDQILEVGTILLQDFIYERVQRQRDGNSAVTREQLDGSQLTDPKHKKLAQCLQHIGDEL
DGNVELQRMINNSSLCPTRKVFMRVASEIFSDGIFNWGRVVALFYFACRLVIKVRETAIADSPFEWVLDFVRVLNFVRVL
DFATV
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-03 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-06 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-05 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=222 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVSFCLSKILGKHEMHKKLTFEIQQRFAFASFVCVCAGVGWGFEFDALLCA
>gnl|bcl2dbpro|A0A3P8R3S9_BOK-04 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVTQSKALCRDYILSRLNQNGLGWSKTELNFSPSNTALAEVSMVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMFAVAGALAVDCVRQGHPATVHILVDSLGQFVRK
FLVPWLKRRGGWVEITKCVVKKDFCPEENWLSSAFESLKCFLTTMYVYIMKEP
>gnl|bcl2dbpro|A0A3P8R8S7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Astatotilapia calliptera GN=BOK (length=210 residues).
MEMLRRSSVFASEVFDRSPTDKELVSQAKALCREYIHSRLNRAGIGWSKPEHGLAASGGTLGEISSVLLWLGDELEYLRP
NVYRNVARQLNITVASESVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKKRGGWVDVTKCVVSTDPNFCSHWLVSAVCAFGHYLKTVVLHLLREK
© 1998-2019