Dataset for protein Bok of organism Aotus nancymaae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5DQ30_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Aotus nancymaae GN=BOK (length=201 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQPKYVHARLLAPERAAPSGRPAEVVAALQAAPGRDELEMIRPSVYRNVARQ
LHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGW
TDVLKCVVSTDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
© 1998-2019