Dataset for protein BAX-like of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A2K5D7G1_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Aotus nancymaae GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPDSPSASEEQVARDTEEVFQSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|A0A2K5D885_BAX-03 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=144 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKV
PELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5D885_BAX-01 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=193 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5D885_BAX-04 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=177 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVT
LLPLPIFRSSDVVSNAF
>gnl|bcl2dbpro|A0A2K5D885_BAX-02 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=172 residues).
MDGSGEQPRGEGEFHPGSSRTPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFS
DGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFFGTPTWQTVTIFVAGV
LTASLTIWKNMG
>gnl|bcl2dbpro|A0A2K5DQ30_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Aotus nancymaae GN=BOK (length=201 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQPKYVHARLLAPERAAPSGRPAEVVAALQAAPGRDELEMIRPSVYRNVARQ
LHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGW
TDVLKCVVSTDPGLRSHWLLAALCSFGRFLKAAFFVLLPER
© 1998-2019