Dataset for protein Bok of organism Anolis carolinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1K8X4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anolis carolinensis GN=BOK (length=215 residues).
MKMDVLRRSSVFAAEVMEVFDRTPTDKELVSQAKVLCRDFIHSRLIRAGIGWNKPEHSVPVPGGKLAEVSNILLRLGDEL
EYIRPNLYRNVARQLNISLHSETVVTDAFLAVATQIFSSGITWGKIVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFV
RKTLVTWMKRRGGWSDITKCVVNTDPNLRSHWLVAAICSFGHFLKAIFFVLLPER
© 1998-2019